HPA060372

IFI44L antibody from Atlas Antibodies
C1orf29, GS3686
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA060372
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA060372, RRID:AB_2684267
Product name
Anti-IFI44L
Provider product page
Atlas Antibodies - HPA060372
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IIDEQLVCRLSKTDIFIICRDNKIYLDKMITRNLK
LRFYGHRQYLECEVFRVEGIKDNLDDIKRIIKARE
HRNRLL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -