Antibody data

Product number
PAB30150
Provider
Abnova Corporation
Product name
IFI44L polyclonal antibody
Provider product page
Abnova Corporation - PAB30150
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against synthetic peptide of human IFI44L.
Antigen sequence
MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGG
SIEDMVERCSRQGCT
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -