AV46166

IFI44L antibody from MilliporeSigma / Merck KGaA
C1orf29, GS3686
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV46166
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV46166, RRID:AB_1851414
Product name
Anti-IFI44L antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV46166
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human IFI44L with an internal ID of P27004
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
IDYNMIVAFMLGNYINLRESSTEPNDSLWFSLQKK
NDTTEIETLLLNTAP
Storage
-20C
Provider Type Product Number
- No reagents -