Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001179-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001179-M02, RRID:AB_1111733
- Product name
- CLCA1 monoclonal antibody (M02), clone 1C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CLCA1.
- Antigen sequence
ALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNP
PRPEINKDDVQHKQVCFSRTSSGGSFVASDVPNAP
IPDLFPPGQITDLKAEIHGGSLINLTWTAP- Isotype
- IgG
- Antibody clone number
- 1C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Profiling of differentially expressed proteins in stage IV colorectal cancers with good and poor outcomes.
Kim HJ, Kang UB, Lee H, Jung JH, Lee ST, Yu MH, Kim H, Lee C
Journal of proteomics 2012 Jun 6;75(10):2983-97
Journal of proteomics 2012 Jun 6;75(10):2983-97
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CLCA1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol