H00126969-B01P

SLC44A3 antibody from Abnova Corporation
CTL3, MGC45474
No application information provided.

Antibody data

Product number
H00126969-B01P
Provider
Abnova Corporation
Product name
SLC44A3 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00126969-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SLC44A3 protein.
Antigen sequence
MGYSVVAGAAGRLLFGYDSFGNMCGKKNSPVEGAP
LSGQDMTLKKHVFFMNSCNLEVKGTQLNRMALCVS
NCPEEQLDSLEEVQFFANTSGSFLCVYSLNSFNYT
HSPKADSLCPRLPVPPSKSFPLFNRCVPQTPECYS
LFASVLINDVDTLHRILSGIMSGRDTILGLCILAL
ALSLAMMFTFRFITTLLVHIFISLVILGLLFVCGV
LWWLYYDYTNDLSIELDTERENMKCVLGFAIVSTG
ITAVLLVLIFVLRKRIKLTVELFQITNKAISSAPF
LLFQPLWTFAILIFFWVLWVAVLLSLGTAGAAQVM
EGGQVEYKPLSGIRYMWSYHLIGLIWTSEFILACQ
QMTIAGAVVTCYFNRSKNDPPDHPILSSLSILFFY
HQGTIVKGSFLISVVRIPRIIVMYMQNALKEQQHG
ALSRYLFRCCYCCFWCLDKYLLHLNQNAYTTTAIN
GTDFCTSAKDAFKILSKNSSHFTSINCFGDFIIFL
GKVLVVCFTVFGGLMAFNYNRAFQVWAVPLLLVAF
FAYLVAHSFLSVFETVLDALFLCFAVDLETNDGSS
EKPYFMDQEFLSFVKRSNKLNNARAQQDKHSLRNE
EGTELQAIVR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -