HPA047433

SLC44A3 antibody from Atlas Antibodies
CTL3, MGC45474
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA047433
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA047433, RRID:AB_2680046
Product name
Anti-SLC44A3
Provider product page
Atlas Antibodies - HPA047433
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMT
LKKHVFFMNSCNLEVKGTQLNRMALCVSNCPEEQL
DSLEEVQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -