Antibody data

Product number
ABIN405623
Provider
antibodies-online
Product name
anti-Solute Carrier Family 44, Member 3 (SLC44A3) antibody
Provider product page
antibodies-online - ABIN405623
Antibody type
Polyclonal
Antigen
The immunogen for anti-SLC44A3 antibody: synthetic peptide directed towards the middle region of human SLC44A3
Reactivity
Human, Mouse, Rat, Bovine
Host
Rabbit
Antigen sequence
TFAILIFFWVLWVAVLLSLGTAGAAQVMEGGQVEY
KPLSG IRYMWSYHLI
Vial size
50 µg
Provider Type Product Number
- No reagents -