SAB2102217

SLC44A3 antibody from Sigma-Aldrich
CTL3, MGC45474
No application information provided.

Antibody data

Product number
SAB2102217
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2102217, RRID:AB_10600574
Product name
Anti-SLC44A3 (ab1) antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2102217
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_689582.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TFAILIFFWVLWVAVLLSLGTAGAAQVMEGGQVEY
KPLSGIRYMWSYHLI
Storage
-20C
Provider Type Product Number
- No reagents -