Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029090 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029090, RRID:AB_10671359
- Product name
- Anti-EIF5A2
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGE
LGKEIEGKYNAGEDVQVSVMCAMSEEYAVA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references ECT2 amplification and overexpression as a new prognostic biomarker for early-stage lung adenocarcinoma.
Murata Y, Minami Y, Iwakawa R, Yokota J, Usui S, Tsuta K, Shiraishi K, Sakashita S, Satomi K, Iijima T, Noguchi M
Cancer science 2014 Apr;105(4):490-7
Cancer science 2014 Apr;105(4):490-7
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear membranous positivity in subset of cells in seminiferous ducts and in Leydig cells.
- Sample type
- HUMAN