Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056648-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056648-M01, RRID:AB_509170
- Product name
- EIF5A2 monoclonal antibody (M01), clone 1E7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EIF5A2.
- Antigen sequence
GKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLS
LLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQV
SVMCAMSEEYAVAIKPCK- Isotype
- IgG
- Antibody clone number
- 1E7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A hypusine-eIF5A-PEAK1 switch regulates the pathogenesis of pancreatic cancer.
Fujimura K, Wright T, Strnadel J, Kaushal S, Metildi C, Lowy AM, Bouvet M, Kelber JA, Klemke RL
Cancer research 2014 Nov 15;74(22):6671-81
Cancer research 2014 Nov 15;74(22):6671-81
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of EIF5A2 expression in transfected 293T cell line by EIF5A2 monoclonal antibody (M01), clone 1E7.Lane 1: EIF5A2 transfected lysate(16.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged EIF5A2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol