Explore
Validate
Learn
Immunocytochemistry
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014275 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA014275, RRID:AB_10599820
- Product name
- Anti-MARCH7
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ILPGSLFRFAVPPALGSNLTDNVMITVDIIPSGWN
SADGKSDKTKSAPSRDPERLQKIK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The E3 ligase axotrophin/MARCH-7: protein expression profiling of human tissues reveals links to adult stem cells.
Szigyarto CA, Sibbons P, Williams G, Uhlen M, Metcalfe SM
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2010 Apr;58(4):301-8
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2010 Apr;58(4):301-8
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, colon, liver and lymph node using Anti-MARCH7 antibody HPA014275 (A) shows similar protein distribution across tissues to independent antibody HPA022152 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-MARCH7 antibody HPA014275.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node using Anti-MARCH7 antibody HPA014275.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-MARCH7 antibody HPA014275.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-MARCH7 antibody HPA014275.
- Sample type
- HUMAN
