HPA044933

antibody from Atlas Antibodies

Targeting: COBLL1 KIAA0977

Antibody data

Submit

Validation data

Product number: HPA044933 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA044933, RRID:AB_2679148
Product name: Anti-COBLL1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NNSAHNEQNSQIPTPTDGPSFTVMRQSSLTFQSSD PEQMRQSLLTAIRSGEAAAKLKRVTIPSNTISVNG RSRLSHSMSPD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

COBLL1 protein structure - HPA044933 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and skeletal muscle tissues using Anti-COBLL1 antibody. Corresponding COBLL1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, placenta and skeletal muscle using Anti-COBLL1 antibody HPA044933 (A) shows similar protein distribution across tissues to independent antibody HPA053344 (B).
Antibody #2 product nr: HPA053344
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-COBLL1 antibody HPA044933.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-COBLL1 antibody HPA044933.
Sample type: HUMAN