Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [5]
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA042589 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA042589, RRID:AB_10793885
- Product name
- Anti-AHCYL1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVT
KAPKKQIQFADDMQEFTK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- klas2
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting AHCYL1 or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting AHCYL1 Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
- Sample type
- U-2 OS
- Primary Ab dilution
- 1:58
- Conjugate
- Horseradish Peroxidase
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:3000
- Knockdown/Genetic Approaches Application
- Western blot
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-AHCYL1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows moderate cytoplasmic and membranous positivity in ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows weak membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows moderate membranous and cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows moderate membranous positivity in exocrine glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate membranous positivity in glandular cells.
- Sample type
- HUMAN