Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010768-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010768-M05, RRID:AB_529953
- Product name
- AHCYL1 monoclonal antibody (M05), clone 5D6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AHCYL1.
- Antigen sequence
MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVT
KAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQS
STDSYSSAASYTDSSDDEVSPREKQQTNSKG- Isotype
- IgG
- Antibody clone number
- 5D6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Protein extraction of formalin-fixed, paraffin-embedded tissue enables robust proteomic profiles by mass spectrometry.
Scicchitano MS, Dalmas DA, Boyce RW, Thomas HC, Frazier KS
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2009 Sep;57(9):849-60
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society 2009 Sep;57(9):849-60
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- AHCYL1 monoclonal antibody (M05), clone 5D6 Western Blot analysis of AHCYL1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of AHCYL1 expression in transfected 293T cell line by AHCYL1 monoclonal antibody (M05), clone 5D6.Lane 1: AHCYL1 transfected lysate(69 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged AHCYL1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to AHCYL1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol