Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001857-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001857-M04, RRID:AB_565646
- Product name
- DVL3 monoclonal antibody (M04), clone 4H2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DVL3.
- Antigen sequence
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKG
VLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCF
NGRVVSWLVSAEGSHPDPAPFCADNPSELP- Isotype
- IgG
- Antibody clone number
- 4H2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- DVL3 monoclonal antibody (M04), clone 4H2 Western Blot analysis of DVL3 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of DVL3 expression in transfected 293T cell line by DVL3 monoclonal antibody (M04), clone 4H2.Lane 1: DVL3 transfected lysate(78 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged DVL3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to DVL3 on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol