Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029248 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029248, RRID:AB_10601855
- Product name
- Anti-SENP2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSII
ETKEKNCSGKERDRRTDDLLELTEDMEKEISNALG
HGPQDEILSSAFKL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Integrative genomics analysis identifies candidate drivers at 3q26-29 amplicon in squamous cell carcinoma of the lung.
Wang J, Qian J, Hoeksema MD, Zou Y, Espinosa AV, Rahman SM, Zhang B, Massion PP
Clinical cancer research : an official journal of the American Association for Cancer Research 2013 Oct 15;19(20):5580-90
Clinical cancer research : an official journal of the American Association for Cancer Research 2013 Oct 15;19(20):5580-90
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
- Sample type
- HUMAN