Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010286-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010286-M01, RRID:AB_509257
- Product name
- BCAS2 monoclonal antibody (M01), clone 1D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BCAS2.
- Antigen sequence
HQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQ
KELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNW
VSLVSKNYEIERTIVQLENEIYQIKQQHGEANKEN
IRQDF- Isotype
- IgG
- Antibody clone number
- 1D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A quantitative proteomic analysis uncovers the relevance of CUL3 in bladder cancer aggressiveness.
Grau L, Luque-Garcia JL, González-Peramato P, Theodorescu D, Palou J, Fernandez-Gomez JM, Sánchez-Carbayo M
PloS one 2013;8(1):e53328
PloS one 2013;8(1):e53328
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BCAS2 monoclonal antibody (M01), clone 1D10 Western Blot analysis of BCAS2 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of BCAS2 expression in transfected 293T cell line by BCAS2 monoclonal antibody (M01), clone 1D10.Lane 1: BCAS2 transfected lysate(26.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BCAS2 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
