102-PA135S

LEP antibody from ReliaTech GmbH
OB, OBS
Western blot
Supportive data in Antibodypedia
Immunocytochemistry
Recommended by provider

Antibody data

Product number
102-PA135S
Provider
ReliaTech GmbH
Product name
Anti-human Leptin
Provider product page
ReliaTech GmbH - 102-PA135S
Antibody type
Polyclonal
Antigen
Other
Description
antibody Protein-A purified from serum
Reactivity
Human
Host
Rabbit
Antigen sequence
MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQ
KVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMP
SRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGL
ETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQ
LDLSPGCLEHHHHHH
Vial size
100 µg
Storage
The lyophilized antibody is stable at room temperature for up to 1 month. The reconstituted antibody is stable for at least two weeks at 2-8 °C. Frozen aliquots are stable for at least 6 months when stored at -20 °C.
Handling
The antibody solution should be gently mixed before use.
Provider Type Product Number
- No reagents -