Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28533 - Provider product page
- Provider
- Abnova Corporation
- Product name
- GPKOW polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant GPKOW.
- Antigen sequence
MPRPDEEQEKDKEDQPQGLVPGGAVVVLSGPHRGL
YGKVEGLDPDNVRAMVRLAVGSRVVTVSEYYLRPV
SQQEFDKNTLDLRQQNGTASSRKTLWNQELYIQQD
NSERKRKHLPD- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with GPKOW polyclonal antibody (Cat # PAB28533) at 1:250-1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS with GPKOW polyclonal antibody (Cat # PAB28533) at 1-4 ug/ml shows positivity in nucleus but not nucleoli.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas with GPKOW polyclonal antibody (Cat # PAB28533) shows strong nuclear positivity in exocrine glandular cells and islet cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)