SAB1402021

ZSWIM2 antibody from MilliporeSigma / Merck KGaA
MEX, MGC33890, ZZZ2
No application information provided.

Antibody data

Product number
SAB1402021
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1402021, RRID:AB_10609457
Product name
Anti-ZSWIM2 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1402021
Antibody type
Polyclonal
Antigen
ZSWIM2 (AAH31094.1, 1 - 633 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MLRRGYKASERRRHLSERLSWHQDQALSSSIYLLR
EMGPTGFLLREEEPEYMDFRVFLGNPHVCNCSTFP
KGGELCKHICWVLLKKFELPRNHESALQLGLGERE
ISDLLRGIHRVQTPQPGTNDENEHVEEDGYIKQKE
IDSEDICSICQELLLEKKLPVTFCRFGCGNSIHIK
CMKILANYQSTSNTSMLKCPLCRKEFAPLKLILEE
FKNSSKLVAAAEKERLDKHLGIPCNNCKQFPIEGK
CYKCTECIEY
Storage
-20C
Provider Type Product Number
- No reagents -