Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- SAB1402022 - Provider product page

- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Monoclonal Anti-ZSWIM2 antibody produced in mouse
- Antibody type
- Monoclonal
- Antigen
- ZSWIM2 (NP_872327, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Description
- purified immunoglobulin
- Reactivity
- Human
- Antigen sequence
MLRRGYKASERRRHLSERLSWHQDQALSSSIYLLR
EMGPTGFLLREEEPEYMDFRVFLGNPHVCNCSTFP
KGGELCKHICWVLLKKFKLPRNHESALQL*- Isotype
- IgG
- Storage
- -20C
No comments: Submit comment
No validations: Submit validation data