SAB1402022

ZSWIM2 antibody from MilliporeSigma / Merck KGaA
MEX, MGC33890, ZZZ2
ELISA
Recommended by provider

Antibody data

Product number
SAB1402022
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1402022, RRID:AB_10609725
Product name
Monoclonal Anti-ZSWIM2 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1402022
Antibody type
Monoclonal
Antigen
ZSWIM2 (NP_872327, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MLRRGYKASERRRHLSERLSWHQDQALSSSIYLLR
EMGPTGFLLREEEPEYMDFRVFLGNPHVCNCSTFP
KGGELCKHICWVLLKKFKLPRNHESALQL*
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -