HPA036541

antibody from Atlas Antibodies

Targeting: HIBCH

Antibody data

Submit

Validation data

Product number: HPA036541 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA036541, RRID:AB_2675182
Product name: Anti-HIBCH
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GSSFALEQLKVINKMSPTSLKITLRQLMEGSSKTL QEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSP KWKPADLKEVTEEDLNNHFKSLGSSDL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

HIBCH protein structure - HPA036541 shown in red.

Enhanced validation

Submitted by: klas2
Enhanced method: Genetic validation
Main image
Experimental details: Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting HIBCH or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting HIBCH Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
Sample type: U-2 OS
Primary Ab dilution: 1:376
Conjugate: Horseradish Peroxidase
Secondary Ab: Secondary Ab
Secondary Ab dilution: 1:3000
Knockdown/Genetic Approaches Application: Western blot
KD Reagent Type: siRNA
Downregulation: >75%
KD Reagent Prod no: s25350
KD Reagent Prod page: KD Reagent Prod page
KD Reagent Provider: Thermo Fisher Scientific
KD Reagent Page 2: KD Reagent Page 2
KD Reagent Prod no 2: s223690
KD Reagent Page 3: KD Reagent Page 3
KD Reagent Prod no 3: s25349
Antibody Lot Number: R34267
Appendix: 566c6077b0ab0.pdf

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Genetic validation
Main image
Experimental details: Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HIBCH antibody. Remaining relative intensity is presented.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Western blot analysis using Anti-HIBCH antibody HPA036541 (A) shows similar pattern to independent antibody HPA036540 (B).
Antibody #2 product nr: HPA036540
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and skeletal muscle tissues using Anti-HIBCH antibody. Corresponding HIBCH RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and skeletal muscle using Anti-HIBCH antibody HPA036541 (A) shows similar protein distribution across tissues to independent antibody HPA036540 (B).
Antibody #2 product nr: HPA036540
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-HIBCH antibody HPA036541.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-HIBCH antibody HPA036541.
Sample type: HUMAN