Explore
Validate
Learn
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010962-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010962-M01, RRID:AB_425875
- Product name
- AF1Q monoclonal antibody (M01), clone 2A9-1B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant AF1Q.
- Antigen sequence
MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDT
ATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYS
TFNFWRAPIASIHSFELDLL- Isotype
- IgG
- Antibody clone number
- 2A9-1B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references MLLT11/AF1q is differentially expressed in maturing neurons during development.
AF1q: a novel mediator of basal and 4-HPR-induced apoptosis in ovarian cancer cells.
AF1q/MLLT11 regulates the emergence of human prothymocytes through cooperative interaction with the Notch signaling pathway.
Identification of the functional role of AF1Q in the progression of breast cancer.
Oncogene AF1q enhances doxorubicin-induced apoptosis through BAD-mediated mitochondrial apoptotic pathway.
Yamada M, Clark J, Iulianella A
Gene expression patterns : GEP 2014 Jul;15(2):80-7
Gene expression patterns : GEP 2014 Jul;15(2):80-7
AF1q: a novel mediator of basal and 4-HPR-induced apoptosis in ovarian cancer cells.
Tiberio P, Cavadini E, Callari M, Daidone MG, Appierto V
PloS one 2012;7(6):e39968
PloS one 2012;7(6):e39968
AF1q/MLLT11 regulates the emergence of human prothymocytes through cooperative interaction with the Notch signaling pathway.
Parcelier A, Maharzi N, Delord M, Robledo-Sarmiento M, Nelson E, Belakhdar-Mekid H, Pla M, Kuranda K, Parietti V, Goodhardt M, Legrand N, Bernstein ID, Gluckman JC, Sigaux F, Canque B
Blood 2011 Aug 18;118(7):1784-96
Blood 2011 Aug 18;118(7):1784-96
Identification of the functional role of AF1Q in the progression of breast cancer.
Chang XZ, Li DQ, Hou YF, Wu J, Lu JS, Di GH, Jin W, Ou ZL, Shen ZZ, Shao ZM
Breast cancer research and treatment 2008 Sep;111(1):65-78
Breast cancer research and treatment 2008 Sep;111(1):65-78
Oncogene AF1q enhances doxorubicin-induced apoptosis through BAD-mediated mitochondrial apoptotic pathway.
Co NN, Tsang WP, Wong TW, Cheung HH, Tsang TY, Kong SK, Kwok TT
Molecular cancer therapeutics 2008 Oct;7(10):3160-8
Molecular cancer therapeutics 2008 Oct;7(10):3160-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MLLT11 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
