H00057181-M03
antibody from Abnova Corporation
Targeting: SLC39A10
DKFZp564L2123, FLJ90515, KIAA1265
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057181-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057181-M03, RRID:AB_1714148
- Product name
- SLC39A10 monoclonal antibody (M03), clone 1F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SLC39A10.
- Antigen sequence
CIRMFKHYKQQRGKQKWFMKQNTEESTIGRKLSDH
KLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELT
DLEGQQESPPKNYLCIEEEKIIDHSHSDGLHTIHE
HDL- Isotype
- IgG
- Antibody clone number
- 1F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SLC39A10 expression in transfected 293T cell line by SLC39A10 monoclonal antibody (M03), clone 1F6.Lane 1: SLC39A10 transfected lysate (Predicted MW: 94.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SLC39A10 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol