HPA034609

antibody from Atlas Antibodies

Targeting: HECW2 KIAA1301, NEDL2

Antibody data

Submit

Validation data

Product number: HPA034609 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA034609, RRID:AB_10669993
Product name: Anti-HECW2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TATCSERSMGASPKLRSSFPTDTRLNAMLHIDSDE EDHEFQQDLGYPSSLEEEGGLIMFSRASRADDGSL TSQTKLEDNPVENEEASTHEAASFEDKPENLP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

HECW2 protein structure - HPA034609 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and duodenum tissues using HPA034609 antibody. Corresponding HECW2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows strong cytoplasmic positivity in subsets of alveolar cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in glial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows no positivity in glandular cells as expected.
Sample type: HUMAN