Antibody data

Product number
HPA030750
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA030750, RRID:AB_2673591
Product name
Anti-GRB2
Provider product page
Atlas Antibodies - HPA030750
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWW
KGACHGQTGMFPRNYVTPVNRNV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -