HPA035793

FLACC1 antibody from Atlas Antibodies
ALS2CR12
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA035793
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA035793, RRID:AB_10602429
Product name
Anti-ALS2CR12
Provider product page
Atlas Antibodies - HPA035793
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HSARQEETNKSFYEVINVSPGYQLVRNREQISVTL
GDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQIS
ELTAIIEQMNR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -