HPA035793

FLACC1 antibody from Sigma-Aldrich
ALS2CR12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035793
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA035793, RRID:AB_10602429
Product name
Anti-ALS2CR12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA035793
Antibody type
Polyclonal
Antigen
amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSARQEETNKSFYEVINVSPGYQLVRNREQISVTL
GDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQIS
ELTAIIEQMNR
Storage
-20C
Provider Type Product Number
- No reagents -