SAB2100112

FLACC1 antibody from Sigma-Aldrich
ALS2CR12
No application information provided.

Antibody data

Product number
SAB2100112
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100112, RRID:AB_10602845
Product name
Anti-ALS2CR12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100112
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_631902.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQ
EETNKSFYEVINVSP
Storage
-20C
Provider Type Product Number
- No reagents -