Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055585-B01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055585-B01, RRID:AB_1116028
- Product name
- UBE2Q1 MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human UBE2Q1 protein.
- Antigen sequence
MELLTKQGWSSAYSIESVIMQISATLVKGKARVQF
GANKSQYSLTRAQQSYKSLVQIHEKNGWYTPPKED
G- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of UBE2Q1 expression in transfected 293T cell line (H00055585-T01) by UBE2Q1 MaxPab polyclonal antibody.Lane 1: UBE2Q1 transfected lysate(7.81 KDa).Lane 2: Non-transfected lysate.