HPA059155

antibody from Atlas Antibodies

Targeting: CYP27A1 CP27, CTX, CYP27

Antibody data

Submit

Validation data

Product number: HPA059155 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA059155, RRID:AB_2683933
Product name: Anti-CYP27A1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVL YKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEG KYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQL RQALNQRLLKPAEAALYTDAFNEVIDDFMTRLD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CYP27A1 protein structure - HPA059155 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and pancreas tissues using HPA059155 antibody. Corresponding CYP27A1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows weak cytoplasmic positivity in exocrine glandular cells and in Langerhans islet cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Sample type: HUMAN