HPA027189

antibody from Atlas Antibodies

Targeting: CCDC181 C1orf114, FLJ25846

Antibody data

Submit

Validation data

Product number: HPA027189 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA027189, RRID:AB_10599252
Product name: Anti-CCDC181
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EVRRYIMEKIVQANKLLQNQEPVNDKRERKLKFKD QLVDLEVPPLEDTTTSKNYFENERNMFGKLSQLCI SNDFGQEDVLLSLTNGSCE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CCDC181 protein structure - HPA027189 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-CCDC181 antibody. Corresponding CCDC181 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human bronchus, fallopian tube, liver and prostate using Anti-CCDC181 antibody HPA027189 (A) shows similar protein distribution across tissues to independent antibody HPA027275 (B).
Antibody #2 product nr: HPA027275, HPA027312, HPA027281
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bronchus using Anti-CCDC181 antibody HPA027189.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-CCDC181 antibody HPA027189.
Sample type: HUMAN