Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00092344-B01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00092344-B01, RRID:AB_1138725
- Product name
- SCYL1BP1 MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human SCYL1BP1 protein.
- Antigen sequence
MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSE
EELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALV
EQSQKLGLQDGSTSLLPEQLLSAPKQRVNVQKPPF
SSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENS
HDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQ
QEQRLMEEKNKRKKALLAKAIAERSKRTQAETMKL
KRIQKELQALDDMVSADIGILRNRIDQASLDYSYA
R- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SCYL1 binding protein 1 promotes the ubiquitin-dependent degradation of Pirh2 and has tumor-suppressive function in the development of hepatocellular carcinoma.
Hu L, Liu M, Chen L, Chan TH, Wang J, Huo KK, Zheng BJ, Xie D, Guan XY
Carcinogenesis 2012 Aug;33(8):1581-8
Carcinogenesis 2012 Aug;33(8):1581-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SCYL1BP1 expression in transfected 293T cell line (H00092344-T01) by SCYL1BP1 MaxPab polyclonal antibody.Lane 1: SCYL1BP1 transfected lysate(27.06 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SCYL1BP1 MaxPab polyclonal antibody. Western Blot analysis of SCYL1BP1 expression in human colon.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to SCYL1BP1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol