HPA036835

antibody from Atlas Antibodies

Targeting: TRIP12 KIAA0045, TRIPC, ULF

Antibody data

Submit

Validation data

Product number: HPA036835 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA036835, RRID:AB_2675340
Product name: Anti-TRIP12
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: AMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGN IPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRA MQRLLDTNPEINQSDSQD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TRIP12 protein structure - HPA036835 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and liver tissues using HPA036835 antibody. Corresponding TRIP12 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human Fallopian tube shows weak nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows moderate nuclear positivity in myocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Sample type: HUMAN