WH0010228M1

STX6 antibody from MilliporeSigma / Merck KGaA
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0010228M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0010228M1, RRID:AB_1843840
Product name
Monoclonal Anti-STX6 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0010228M1
Antibody type
Monoclonal
Antigen
STX6 (AAH09944, a.a. 1-256) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDP
STATREEIDWTTNELRNNLRSIEWDLEDLDETISI
VEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQ
MSTSSVQALAERKNRQALLGDSGSQNWSTGTTDKY
GRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLEL
VSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELES
TQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVL
LVVLILFLVL (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -