H00010216-M01
antibody from Abnova Corporation
Targeting: PRG4
bG174L6.2, CACP, FLJ32635, HAPO, JCAP, MSF, SZP
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010216-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010216-M01, RRID:AB_606838
- Product name
- PRG4 monoclonal antibody (M01), clone 2A6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PRG4.
- Antigen sequence
ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKV
SILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQ
YYNIDVPSRTARAITTRSGQTLSKVWYNCP- Isotype
- IgG
- Antibody clone number
- 2A6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Interactive cytokine regulation of synoviocyte lubricant secretion.
Blewis ME, Lao BJ, Schumacher BL, Bugbee WD, Sah RL, Firestein GS
Tissue engineering. Part A 2010 Apr;16(4):1329-37
Tissue engineering. Part A 2010 Apr;16(4):1329-37
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PRG4 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PRG4 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol