Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00091156-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00091156-A01, RRID:AB_462947
- Product name
- DKFZp434B1231 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant DKFZp434B1231.
- Antigen sequence
GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQ
RDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGC
ECCMSCAVQGSPRPHVTWFKNDRSLEGNP- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of molecular tumor markers in renal cell carcinomas with TFE3 protein expression by RNA sequencing.
Pflueger D, Sboner A, Storz M, Roth J, Compérat E, Bruder E, Rubin MA, Schraml P, Moch H
Neoplasia (New York, N.Y.) 2013 Nov;15(11):1231-40
Neoplasia (New York, N.Y.) 2013 Nov;15(11):1231-40
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- DKFZp434B1231 polyclonal antibody (A01), Lot # 051024JC01 Western Blot analysis of DKFZp434B1231 expression in Jurkat ( Cat # L017V1 ).