HPA060548

D2HGDH antibody from Atlas Antibodies
D2HGD, FLJ42195, MGC25181

Antibody data

Product number
HPA060548
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA060548, RRID:AB_2732650
Product name
Anti-D2HGDH
Provider product page
Atlas Antibodies - HPA060548
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVS
HILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIIL
STARMNRVLSFHSVS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.