HPA054437
antibody from Atlas Antibodies
Targeting: SIRPA
BIT, CD172a, MFR, MYD-1, P84, PTPNS1, SHPS-1, SHPS1, SIRP, SIRP-ALPHA-1, SIRPalpha, SIRPalpha2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA054437 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA054437, RRID:AB_2682488
- Product name
- Anti-SIRPA
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTP
KQPAPKPEPSFSEYASVQVPRK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, colon, kidney and liver using Anti-SIRPA antibody HPA054437 (A) shows similar protein distribution across tissues to independent antibody HPA058511 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-SIRPA antibody HPA054437.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-SIRPA antibody HPA054437.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-SIRPA antibody HPA054437.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-SIRPA antibody HPA054437.
- Sample type
- HUMAN