H00025936-A01

NSL1 antibody from Abnova Corporation
C1orf48, DC8, DKFZP566O1646, MIS14
No application information provided.

Antibody data

Product number
H00025936-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025936-A01, RRID:AB_627322
Product name
C1orf48 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00025936-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant C1orf48.
Antigen sequence
KEISEAMKSLPALIEQGEGFSQVLRMQPVIHLQRI
HQEVFSSCHRKPDAKPENFITQIETTPTETASRKT
SDVVLKRKQTKDCPQRKWYPLRPKKINL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.