HPA053721

NSL1 antibody from Atlas Antibodies
C1orf48, DC8, DKFZP566O1646, MIS14

Antibody data

Product number
HPA053721
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA053721, RRID:AB_2682240
Product name
Anti-NSL1
Provider product page
Atlas Antibodies - HPA053721
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RKILECVIKTIKAKQEILKQYHPVVHPLDLKYDPD
PAPHMENLKCRGETVAKEISEAMKSLPALIEQGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.