HPA045761

NSL1 antibody from Atlas Antibodies
C1orf48, DC8, DKFZP566O1646, MIS14

Antibody data

Product number
HPA045761
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA045761, RRID:AB_2679444
Product name
Anti-NSL1
Provider product page
Atlas Antibodies - HPA045761
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FVQKLGDALPEEIREPALRDAQWTFESAVQENISI
NGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATK
RKQYP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.