Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [68]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA32AG - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- Prox-1
- Antibody type
- Polyclonal
- Antigen
- Recombinant human Prox-1
- Description
- antibody affinity purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGL
SPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRC
ITSQLIKWFSNFREFYYIQMEKYARQAINDGVTST
EELSITRDCELYRALNMHYNKANDFEVPERFLEVA
QITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSE
VPEIFKSPNCLQELLHE- Antibody clone number
- Rabbit IG
- Vial size
- 50 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
Submitted references Three-Dimensional Histological Characterization of the Placental Vasculature Using Light Sheet Microscopy
Erythematous capillary-lymphatic malformations mimicking blood vascular anomalies.
A human initial lymphatic chip reveals distinct mechanisms of primary lymphatic valve dysfunction in acute and chronic inflammation.
Repetitive and compulsive behavior after Early-Life-Pain associated with reduced long-chain sphingolipid species.
The lymphatic vascular system: much more than just a sewer.
Expression Profile of CD157 Reveals Functional Heterogeneity of Capillaries in Human Dermal Skin.
Transcriptome Analysis of Hypoxic Lymphatic Endothelial Cells Indicates Their Potential to Contribute to Extracellular Matrix Rearrangement.
High CD206 levels in Hodgkin lymphoma-educated macrophages are linked to matrix-remodeling and lymphoma dissemination.
Absence of lymphatic vessels in term placenta.
Distinct fibroblast subsets regulate lacteal integrity through YAP/TAZ-induced VEGF-C in intestinal villi.
Non-canonical WNT-signaling controls differentiation of lymphatics and extension lymphangiogenesis via RAC and JNK signaling.
Podoplanin and PROX1 Expression in Hypercaloric Diet-induced Pancreatic Injuries.
Paraxial Mesoderm Is the Major Source of Lymphatic Endothelium.
PIK3CA mutations are specifically localized to lymphatic endothelial cells of lymphatic malformations.
Interleukin-17A negatively regulates lymphangiogenesis in T helper 17 cell-mediated inflammation
Impaired angiopoietin/Tie2 signaling compromises Schlemm’s canal integrity and induces glaucoma
Differential Postnatal Expression of Neuronal Maturation Markers in the Dentate Gyrus of Mice and Rats
Time-lapse imaging reveals highly dynamic structural maturation of postnatally born dentate granule cells in organotypic entorhino-hippocampal slice cultures
Vitamin D inhibits lymphangiogenesis through VDR-dependent mechanisms
TGF-β1 Is Present at High Levels in Wound Fluid from Breast Cancer Patients Immediately Post-Surgery, and Is Not Increased by Intraoperative Radiation Therapy (IORT)
Morphological and Molecular Characterization of Human Dermal Lymphatic Collectors
Integration of CD45-positive leukocytes into newly forming lymphatics of adult mice
Aberrant Activation of Notch Signaling Inhibits PROX1 Activity to Enhance the Malignant Behavior of Thyroid Cancer Cells
The lymphatic vascular system of the mouse head
TH2 cells and their cytokines regulate formation and function of lymphatic vessels
Inhibition of VEGFR-3 activation in tumor-draining lymph nodes suppresses the outgrowth of lymph node metastases in the MT-450 syngeneic rat breast cancer model
ΔNp63 isoform-mediated β-defensin family up-regulation is associated with (lymph)angiogenesis and poor prognosis in patients with squamous cell carcinoma
The chick chorioallantoic membrane as an in vivo xenograft model for Burkitt lymphoma
Lymphatic vascular response to acute inflammation.
VEGF-A regulated by progesterone governs uterine angiogenesis and vascular remodelling during pregnancy.
PROX1: A Lineage Tracer for Cortical Interneurons Originating in the Lateral/Caudal Ganglionic Eminence and Preoptic Area
Interleukin-8 reduces post-surgical lymphedema formation by promoting lymphatic vessel regeneration
Prox1 suppresses the proliferation of neuroblastoma cells via a dual action in p27-Kip1 and Cdc25A
Lymphatic Reprogramming by Kaposi Sarcoma Herpes Virus Promotes the Oncogenic Activity of the Virus-Encoded G-protein-Coupled Receptor
Postradiation cutaneous angiosarcoma after treatment of breast carcinoma is characterized by MYC amplification in contrast to atypical vascular lesions after radiotherapy and control cases: clinicopathological, immunohistochemical and molecular analysis of 66 cases
Transcriptional Analysis of Gli3 Mutants Identifies Wnt Target Genes in the Developing Hippocampus
Erythropoietin Induces Lymph Node Lymphangiogenesis and Lymph Node Tumor Metastasis
Visualization of lymphatic vessels by Prox1-promoter directed GFP reporter in a bacterial artificial chromosome-based transgenic mouse
Absence of lymphatic vessels in the dog dental pulp: an immunohistochemical study
miR-31 Functions as a Negative Regulator of Lymphatic Vascular Lineage-Specific Differentiation In Vitro and Vascular Development In Vivo
An exquisite cross-control mechanism among endothelial cell fate regulators directs the plasticity and heterogeneity of lymphatic endothelial cells
CXCR4 Signaling Regulates Metastasis of Chemoresistant Melanoma Cells by a Lymphatic Metastatic Niche
Homeobox Transcription Factor Prox1 in Sympathetic Ganglia of Vertebrate Embryos: Correlation With Human Stage 4s Neuroblastoma
Kaposin-B Enhances the PROX1 mRNA Stability during Lymphatic Reprogramming of Vascular Endothelial Cells by Kaposi's Sarcoma Herpes Virus
Role of CD11b + Macrophages in Intraperitoneal Lipopolysaccharide-Induced Aberrant Lymphangiogenesis and Lymphatic Function in the Diaphragm
Endothelin-1 Stimulates Lymphatic Endothelial Cells and Lymphatic Vessels to Grow and Invade
Endothelial cells from cord blood CD133+CD34+ progenitors share phenotypic, functional and gene expression profile similarities with lymphatics.
Hepatoblast and mesenchymal cell-specific gene-expression in fetal rat liver and in cultured fetal rat liver cells
Integrin-α9 Is Required for Fibronectin Matrix Assembly during Lymphatic Valve Morphogenesis
Deletion of lysophosphatidic acid receptor LPA1 reduces neurogenesis in the mouse dentate gyrus
Sphingosine-1-phosphate promotes lymphangiogenesis by stimulating S1P1/Gi/PLC/Ca2+ signaling pathways
Jugular Lymphatic Maldevelopment in Turner Syndrome and Trisomy 21: Different Anomalies Leading to Nuchal Edema
Distribution and organization of lymphatic vessels in the mouse gingiva: An immunohistochemical study with LYVE-1
Retinal progenitor cells can produce restricted subsets of horizontal cells
Altered regulation of Prox1-gene-expression in liver tumors
Lymph sacs are not required for the initiation of lymph node formation
Proliferating mesodermal cells in murine embryos exhibiting macrophage and lymphendothelial characteristics
Similarities and differences of human and experimental mouse lymphangiomas
Lymphatic development in mouse small intestine
Elevated expression of VEGFR-3 in lymphatic endothelial cells from lymphangiomas
Lymphatic reprogramming of microvascular endothelial cells by CEA-related cell adhesion molecule-1 via interaction with VEGFR-3 and Prox1.
Induction of lymphangiogenesis in and around axillary lymph node metastases of patients with breast cancer
Differentiation of Lymphatic Endothelial Cells From Embryonic Stem Cells on OP9 Stromal Cells
Loss of Function of the Candidate Tumor Suppressor prox1 by RNA Mutation in Human Cancer Cells
Tumor Lymphangiogenesis in Inflammatory Breast Carcinoma: A Histomorphometric Study
Isolation, purification, and heterogeneity of human lymphatic endothelial cells from different tissues.
Generation and Characterization of Telomerase-Transfected Human Lymphatic Endothelial Cells with an Extended Life Span
Lymphatic regulator PROX1 determines Schlemm canal integrity and identity
Freise L, Behncke R, Allerkamp H, Sandermann T, Chu N, Funk E, Hondrich L, Riedel A, Witzel C, Hansmeier N, Danyel M, Gellhaus A, Dechend R, Hägerling R
Biomolecules 2023;13(6):1009
Biomolecules 2023;13(6):1009
Erythematous capillary-lymphatic malformations mimicking blood vascular anomalies.
Hägerling R, Van Zanten M, Behncke RY, Ulferts S, Hansmeier NR, Märkl B, Witzel C, Ho B, Keeley V, Riches K, Mansour S, Gordon K, Ostergaard P, Mortimer PS
JCI insight 2023 Oct 23;8(20)
JCI insight 2023 Oct 23;8(20)
A human initial lymphatic chip reveals distinct mechanisms of primary lymphatic valve dysfunction in acute and chronic inflammation.
Kraus S, Lee E
Lab on a chip 2023 Dec 5;23(24):5180-5194
Lab on a chip 2023 Dec 5;23(24):5180-5194
Repetitive and compulsive behavior after Early-Life-Pain associated with reduced long-chain sphingolipid species.
Vogel A, Ueberbach T, Wilken-Schmitz A, Hahnefeld L, Franck L, Weyer MP, Jungenitz T, Schmid T, Buchmann G, Freudenberg F, Brandes RP, Gurke R, Schwarzacher SW, Geisslinger G, Mittmann T, Tegeder I
Cell & bioscience 2023 Aug 27;13(1):155
Cell & bioscience 2023 Aug 27;13(1):155
The lymphatic vascular system: much more than just a sewer.
Wilting J, Becker J
Cell & bioscience 2022 Sep 15;12(1):157
Cell & bioscience 2022 Sep 15;12(1):157
Expression Profile of CD157 Reveals Functional Heterogeneity of Capillaries in Human Dermal Skin.
Michalak-Micka K, Rütsche D, Johner L, Moehrlen U, Biedermann T, Klar AS
Biomedicines 2022 Mar 15;10(3)
Biomedicines 2022 Mar 15;10(3)
Transcriptome Analysis of Hypoxic Lymphatic Endothelial Cells Indicates Their Potential to Contribute to Extracellular Matrix Rearrangement.
Becker J, Schwoch S, Zelent C, Sitte M, Salinas G, Wilting J
Cells 2021 Apr 24;10(5)
Cells 2021 Apr 24;10(5)
High CD206 levels in Hodgkin lymphoma-educated macrophages are linked to matrix-remodeling and lymphoma dissemination.
Arlt A, von Bonin F, Rehberg T, Perez-Rubio P, Engelmann JC, Limm K, Reinke S, Dullin C, Sun X, Specht R, Maulhardt M, Linke F, Bunt G, Klapper W, Vockerodt M, Wilting J, Pukrop T, Dettmer K, Gronwald W, Oefner PJ, Spang R, Kube D
Molecular oncology 2020 Mar;14(3):571-589
Molecular oncology 2020 Mar;14(3):571-589
Absence of lymphatic vessels in term placenta.
Becker J, Tchagou Tchangou GE, Schmidt S, Zelent C, Kahl F, Wilting J
BMC pregnancy and childbirth 2020 Jun 29;20(1):380
BMC pregnancy and childbirth 2020 Jun 29;20(1):380
Distinct fibroblast subsets regulate lacteal integrity through YAP/TAZ-induced VEGF-C in intestinal villi.
Hong SP, Yang MJ, Cho H, Park I, Bae H, Choe K, Suh SH, Adams RH, Alitalo K, Lim D, Koh GY
Nature communications 2020 Aug 14;11(1):4102
Nature communications 2020 Aug 14;11(1):4102
Non-canonical WNT-signaling controls differentiation of lymphatics and extension lymphangiogenesis via RAC and JNK signaling.
Lutze G, Haarmann A, Demanou Toukam JA, Buttler K, Wilting J, Becker J
Scientific reports 2019 Mar 18;9(1):4739
Scientific reports 2019 Mar 18;9(1):4739
Podoplanin and PROX1 Expression in Hypercaloric Diet-induced Pancreatic Injuries.
Taran D, Tarlui VN, Ceausu RA, Cimpean AM, Raica M, Sarb S
In vivo (Athens, Greece) 2019 Jul-Aug;33(4):1157-1163
In vivo (Athens, Greece) 2019 Jul-Aug;33(4):1157-1163
Paraxial Mesoderm Is the Major Source of Lymphatic Endothelium.
Stone OA, Stainier DYR
Developmental cell 2019 Jul 22;50(2):247-255.e3
Developmental cell 2019 Jul 22;50(2):247-255.e3
PIK3CA mutations are specifically localized to lymphatic endothelial cells of lymphatic malformations.
Blesinger H, Kaulfuß S, Aung T, Schwoch S, Prantl L, Rößler J, Wilting J, Becker J
PloS one 2018;13(7):e0200343
PloS one 2018;13(7):e0200343
Interleukin-17A negatively regulates lymphangiogenesis in T helper 17 cell-mediated inflammation
Park H, Yuk C, Shin K, Lee S
Mucosal Immunology 2017 September
Mucosal Immunology 2017 September
Impaired angiopoietin/Tie2 signaling compromises Schlemm’s canal integrity and induces glaucoma
Kim J, Park D, Bae H, Park D, Kim D, Lee C, Song S, Chung T, Lim D, Kubota Y, Hong Y, He Y, Augustin H, Oliver G, Koh G
Journal of Clinical Investigation 2017 October;127(10):3877-3896
Journal of Clinical Investigation 2017 October;127(10):3877-3896
Differential Postnatal Expression of Neuronal Maturation Markers in the Dentate Gyrus of Mice and Rats
Radic T, Frieß L, Vijikumar A, Jungenitz T, Deller T, Schwarzacher S
Frontiers in Neuroanatomy 2017 November;11
Frontiers in Neuroanatomy 2017 November;11
Time-lapse imaging reveals highly dynamic structural maturation of postnatally born dentate granule cells in organotypic entorhino-hippocampal slice cultures
Radic T, Jungenitz T, Singer M, Beining M, Cuntz H, Vlachos A, Deller T, Schwarzacher S
Scientific Reports 2017 March;7
Scientific Reports 2017 March;7
Vitamin D inhibits lymphangiogenesis through VDR-dependent mechanisms
Yazdani S, Poosti F, Toro L, Wedel J, Mencke R, Mirković K, de Borst M, Alexander J, Navis G, van Goor H, van den Born J, Hillebrands J
Scientific Reports 2017 March;7
Scientific Reports 2017 March;7
TGF-β1 Is Present at High Levels in Wound Fluid from Breast Cancer Patients Immediately Post-Surgery, and Is Not Increased by Intraoperative Radiation Therapy (IORT)
Scherer S, Bauer J, Schmaus A, Neumaier C, Herskind C, Veldwijk M, Wenz F, Sleeman J, Multhoff G
PLOS ONE 2016 September;11(9)
PLOS ONE 2016 September;11(9)
Morphological and Molecular Characterization of Human Dermal Lymphatic Collectors
Hasselhof V, Sperling A, Buttler K, Ströbel P, Becker J, Aung T, Felmerer G, Wilting J, Dettman R
PLOS ONE 2016 October;11(10)
PLOS ONE 2016 October;11(10)
Integration of CD45-positive leukocytes into newly forming lymphatics of adult mice
Buttler K, Lohrberg M, Gross G, Weich H, Wilting J
Histochemistry and Cell Biology 2016 June;145(6):629-636
Histochemistry and Cell Biology 2016 June;145(6):629-636
Aberrant Activation of Notch Signaling Inhibits PROX1 Activity to Enhance the Malignant Behavior of Thyroid Cancer Cells
Choi D, Ramu S, Park E, Jung E, Yang S, Jung W, Choi I, Lee S, Kim K, Seong Y, Hong M, Daghlian G, Kim D, Shin E, Seo J, Khatchadourian V, Zou M, Li W, De Filippo R, Kokorowski P, Chang A, Kim S, Bertoni A, Furlanetto T, Shin S, Li M, Chen Y, Wong A, Koh C, Geliebter J, Hong Y
Cancer Research 2016 January;76(3):582-593
Cancer Research 2016 January;76(3):582-593
The lymphatic vascular system of the mouse head
Lohrberg M, Wilting J
Cell and Tissue Research 2016 December;366(3):667-677
Cell and Tissue Research 2016 December;366(3):667-677
TH2 cells and their cytokines regulate formation and function of lymphatic vessels
Shin K, Kataru R, Park H, Kwon B, Kim T, Hong Y, Lee S
Nature Communications 2015 December;6(1)
Nature Communications 2015 December;6(1)
Inhibition of VEGFR-3 activation in tumor-draining lymph nodes suppresses the outgrowth of lymph node metastases in the MT-450 syngeneic rat breast cancer model
Quagliata L, Klusmeier S, Cremers N, Pytowski B, Harvey A, Pettis R, Thiele W, Sleeman J
Clinical & Experimental Metastasis 2014 March;31(3):351-365
Clinical & Experimental Metastasis 2014 March;31(3):351-365
ΔNp63 isoform-mediated β-defensin family up-regulation is associated with (lymph)angiogenesis and poor prognosis in patients with squamous cell carcinoma
Suarez-Carmona M, Hubert P, Gonzalez A, Duray A, Roncarati P, Erpicum C, Boniver J, Castronovo V, Noel A, Saussez S, Peulen O, Delvenne P, Herfs M
Oncotarget 2014 April;5(7)
Oncotarget 2014 April;5(7)
The chick chorioallantoic membrane as an in vivo xenograft model for Burkitt lymphoma
Klingenberg M, Becker J, Eberth S, Kube D, Wilting J
BMC Cancer 2014 ;14(1):339
BMC Cancer 2014 ;14(1):339
Lymphatic vascular response to acute inflammation.
Lachance PA, Hazen A, Sevick-Muraca EM
PloS one 2013;8(9):e76078
PloS one 2013;8(9):e76078
VEGF-A regulated by progesterone governs uterine angiogenesis and vascular remodelling during pregnancy.
Kim M, Park HJ, Seol JW, Jang JY, Cho YS, Kim KR, Choi Y, Lydon JP, Demayo FJ, Shibuya M, Ferrara N, Sung HK, Nagy A, Alitalo K, Koh GY
EMBO molecular medicine 2013 Sep;5(9):1415-30
EMBO molecular medicine 2013 Sep;5(9):1415-30
PROX1: A Lineage Tracer for Cortical Interneurons Originating in the Lateral/Caudal Ganglionic Eminence and Preoptic Area
Rubin A, Kessaris N, Henrique D
PLoS ONE 2013 October;8(10)
PLoS ONE 2013 October;8(10)
Interleukin-8 reduces post-surgical lymphedema formation by promoting lymphatic vessel regeneration
Choi I, Lee Y, Chung H, Choi D, Ecoiffier T, Lee H, Kim K, Lee S, Park E, Maeng Y, Kim N, Ladner R, Petasis N, Koh C, Chen L, Lenz H, Hong Y
Angiogenesis 2013 January;16(1):29-44
Angiogenesis 2013 January;16(1):29-44
Prox1 suppresses the proliferation of neuroblastoma cells via a dual action in p27-Kip1 and Cdc25A
Foskolou I, Stellas D, Rozani I, Lavigne M, Politis P
Oncogene 2013 February;32(8):947-960
Oncogene 2013 February;32(8):947-960
Lymphatic Reprogramming by Kaposi Sarcoma Herpes Virus Promotes the Oncogenic Activity of the Virus-Encoded G-protein-Coupled Receptor
Aguilar B, Choi I, Choi D, Chung H, Lee S, Yoo J, Lee Y, Maeng Y, Lee H, Park E, Kim K, Kim N, Baik J, Jung J, Koh C, Hong Y
Cancer Research 2012 November;72(22):5833-5842
Cancer Research 2012 November;72(22):5833-5842
Postradiation cutaneous angiosarcoma after treatment of breast carcinoma is characterized by MYC amplification in contrast to atypical vascular lesions after radiotherapy and control cases: clinicopathological, immunohistochemical and molecular analysis of 66 cases
Mentzel T, Schildhaus H, Palmedo G, Büttner R, Kutzner H
Modern Pathology 2012 January;25(1):75-85
Modern Pathology 2012 January;25(1):75-85
Transcriptional Analysis of Gli3 Mutants Identifies Wnt Target Genes in the Developing Hippocampus
Hasenpusch-Theil K, Magnani D, Amaniti E, Han L, Armstrong D, Theil T
Cerebral Cortex 2012 December;22(12):2878-2893
Cerebral Cortex 2012 December;22(12):2878-2893
Erythropoietin Induces Lymph Node Lymphangiogenesis and Lymph Node Tumor Metastasis
Lee A, Kim D, Lee J, Jung Y, Kang K, Lee S, Park S, Kwak J, Lee S, Lim S, Sung M, Yoon S, Kim W
Cancer Research 2011 June;71(13):4506-4517
Cancer Research 2011 June;71(13):4506-4517
Visualization of lymphatic vessels by Prox1-promoter directed GFP reporter in a bacterial artificial chromosome-based transgenic mouse
Choi I, Chung H, Ramu S, Lee H, Kim K, Lee S, Yoo J, Choi D, Lee Y, Aguilar B, Hong Y
Blood 2011 January;117(1):362-365
Blood 2011 January;117(1):362-365
Absence of lymphatic vessels in the dog dental pulp: an immunohistochemical study
Martin A, Gasse H, Staszyk C
Journal of Anatomy 2010 November;217(5):609-615
Journal of Anatomy 2010 November;217(5):609-615
miR-31 Functions as a Negative Regulator of Lymphatic Vascular Lineage-Specific Differentiation In Vitro and Vascular Development In Vivo
Leslie Pedrioli D, Karpanen T, Dabouras V, Jurisic G, van de Hoek G, Shin J, Marino D, Kalin R, Leidel S, Cinelli P, Schulte-Merker S, Brandli A, Detmar M
Molecular and Cellular Biology 2010 June;30(14):3620-3634
Molecular and Cellular Biology 2010 June;30(14):3620-3634
An exquisite cross-control mechanism among endothelial cell fate regulators directs the plasticity and heterogeneity of lymphatic endothelial cells
Kang J, Yoo J, Lee S, Tang W, Aguilar B, Ramu S, Choi I, Otu H, Shin J, Dotto G, Koh C, Detmar M, Hong Y
Blood 2010 July;116(1):140-150
Blood 2010 July;116(1):140-150
CXCR4 Signaling Regulates Metastasis of Chemoresistant Melanoma Cells by a Lymphatic Metastatic Niche
Kim M, Koh Y, Kim K, Koh B, Nam D, Alitalo K, Kim I, Koh G
Cancer Research 2010 December;70(24):10411-10421
Cancer Research 2010 December;70(24):10411-10421
Homeobox Transcription Factor Prox1 in Sympathetic Ganglia of Vertebrate Embryos: Correlation With Human Stage 4s Neuroblastoma
Becker J, Wang B, Pavlakovic H, Buttler K, Wilting J
Pediatric Research 2010 August;68(2):112-117
Pediatric Research 2010 August;68(2):112-117
Kaposin-B Enhances the PROX1 mRNA Stability during Lymphatic Reprogramming of Vascular Endothelial Cells by Kaposi's Sarcoma Herpes Virus
Yoo J, Kang J, Lee H, Aguilar B, Kafka D, Lee S, Choi I, Lee J, Ramu S, Haas J, Koh C, Hong Y, Ganem D
PLoS Pathogens 2010 August;6(8)
PLoS Pathogens 2010 August;6(8)
Role of CD11b + Macrophages in Intraperitoneal Lipopolysaccharide-Induced Aberrant Lymphangiogenesis and Lymphatic Function in the Diaphragm
Kim K, Koh Y, Jeon B, Jang C, Han J, Kataru R, Schwendener R, Kim J, Koh G
The American Journal of Pathology 2009 October;175(4):1733-1745
The American Journal of Pathology 2009 October;175(4):1733-1745
Endothelin-1 Stimulates Lymphatic Endothelial Cells and Lymphatic Vessels to Grow and Invade
Spinella F, Garrafa E, Di Castro V, Rosano L, Nicotra M, Caruso A, Natali P, Bagnato A
Cancer Research 2009 March;69(6):2669-2676
Cancer Research 2009 March;69(6):2669-2676
Endothelial cells from cord blood CD133+CD34+ progenitors share phenotypic, functional and gene expression profile similarities with lymphatics.
Nguyen VA, Fürhapter C, Obexer P, Stössel H, Romani N, Sepp N
Journal of cellular and molecular medicine 2009 Mar;13(3):522-34
Journal of cellular and molecular medicine 2009 Mar;13(3):522-34
Hepatoblast and mesenchymal cell-specific gene-expression in fetal rat liver and in cultured fetal rat liver cells
Mansuroglu T, Dudás J, Elmaouhoub A, Joza T, Ramadori G
Histochemistry and Cell Biology 2009 July;132(1):11-19
Histochemistry and Cell Biology 2009 July;132(1):11-19
Integrin-α9 Is Required for Fibronectin Matrix Assembly during Lymphatic Valve Morphogenesis
Bazigou E, Xie S, Chen C, Weston A, Miura N, Sorokin L, Adams R, Muro A, Sheppard D, Makinen T
Developmental Cell 2009 August;17(2):175-186
Developmental Cell 2009 August;17(2):175-186
Deletion of lysophosphatidic acid receptor LPA1 reduces neurogenesis in the mouse dentate gyrus
Matas-Rico E, García-Diaz B, Llebrez-Zayas P, López-Barroso D, Santín L, Pedraza C, Smith-Fernández A, Fernández-Llebrez P, Tellez T, Redondo M, Chun J, De Fonseca F, Estivill-Torrús G
Molecular and Cellular Neuroscience 2008 October;39(3):342-355
Molecular and Cellular Neuroscience 2008 October;39(3):342-355
Sphingosine-1-phosphate promotes lymphangiogenesis by stimulating S1P1/Gi/PLC/Ca2+ signaling pathways
Yoon C, Hong B, Moon H, Lim S, Suh P, Kim Y, Chae C, Gho Y
Blood 2008 May;112(4):1129-1138
Blood 2008 May;112(4):1129-1138
Jugular Lymphatic Maldevelopment in Turner Syndrome and Trisomy 21: Different Anomalies Leading to Nuchal Edema
Bekker M, van den Akker N, de Mooij Y, Bartelings M, van Vugt J, Gittenberger-de Groot A
Reproductive Sciences 2008 March;15(3):295-304
Reproductive Sciences 2008 March;15(3):295-304
Distribution and organization of lymphatic vessels in the mouse gingiva: An immunohistochemical study with LYVE-1
Ushijima N, Inoue K, Domon T, Yoshida S
Archives of Oral Biology 2008 July;53(7):652-658
Archives of Oral Biology 2008 July;53(7):652-658
Retinal progenitor cells can produce restricted subsets of horizontal cells
Rompani S, Cepko C
Proceedings of the National Academy of Sciences 2008 January;105(1):192-197
Proceedings of the National Academy of Sciences 2008 January;105(1):192-197
Altered regulation of Prox1-gene-expression in liver tumors
Dudas J, Mansuroglu T, Moriconi F, Haller F, Wilting J, Lorf T, Füzesi L, Ramadori G
BMC Cancer 2008 December;8(1)
BMC Cancer 2008 December;8(1)
Lymph sacs are not required for the initiation of lymph node formation
Vondenhoff M, van de Pavert S, Dillard M, Greuter M, Goverse G, Oliver G, Mebius R
Development 2008 December;136(1):29-34
Development 2008 December;136(1):29-34
Proliferating mesodermal cells in murine embryos exhibiting macrophage and lymphendothelial characteristics
Buttler K, Ezaki T, Wilting J
BMC Developmental Biology 2008 ;8(1):43
BMC Developmental Biology 2008 ;8(1):43
Similarities and differences of human and experimental mouse lymphangiomas
Kasten P, Schnöink G, Bergmann A, Papoutsi M, Buttler K, Rössler J, Weich H, Wilting J
Developmental Dynamics 2007 October;236(10):2952-2961
Developmental Dynamics 2007 October;236(10):2952-2961
Lymphatic development in mouse small intestine
Kim K, Sung H, Koh G
Developmental Dynamics 2007 July;236(7):2020-2025
Developmental Dynamics 2007 July;236(7):2020-2025
Elevated expression of VEGFR-3 in lymphatic endothelial cells from lymphangiomas
Norgall S, Papoutsi M, Rössler J, Schweigerer L, Wilting J, Weich H
BMC Cancer 2007 December;7(1)
BMC Cancer 2007 December;7(1)
Lymphatic reprogramming of microvascular endothelial cells by CEA-related cell adhesion molecule-1 via interaction with VEGFR-3 and Prox1.
Kilic N, Oliveira-Ferrer L, Neshat-Vahid S, Irmak S, Obst-Pernberg K, Wurmbach JH, Loges S, Kilic E, Weil J, Lauke H, Tilki D, Singer BB, Ergün S
Blood 2007 Dec 15;110(13):4223-33
Blood 2007 Dec 15;110(13):4223-33
Induction of lymphangiogenesis in and around axillary lymph node metastases of patients with breast cancer
Van den Eynden G, Van der Auwera I, Van Laere S, Huygelen V, Colpaert C, van Dam P, Dirix L, Vermeulen P, Van Marck E
British Journal of Cancer 2006 October;95(10):1362-1366
British Journal of Cancer 2006 October;95(10):1362-1366
Differentiation of Lymphatic Endothelial Cells From Embryonic Stem Cells on OP9 Stromal Cells
Kono T
Arteriosclerosis, Thrombosis, and Vascular Biology 2006 June;26(9):2070-2076
Arteriosclerosis, Thrombosis, and Vascular Biology 2006 June;26(9):2070-2076
Loss of Function of the Candidate Tumor Suppressor prox1 by RNA Mutation in Human Cancer Cells
Takahashi M, Yoshimoto T, Shimoda M, Kono T, Koizumi M, Yazumi S, Shimada Y, Doi R, Chiba T, Kubo H
Neoplasia 2006 December;8(12):1003-1010
Neoplasia 2006 December;8(12):1003-1010
Tumor Lymphangiogenesis in Inflammatory Breast Carcinoma: A Histomorphometric Study
Van der Auwera I
Clinical Cancer Research 2005 November;11(21):7637-7642
Clinical Cancer Research 2005 November;11(21):7637-7642
Isolation, purification, and heterogeneity of human lymphatic endothelial cells from different tissues.
Garrafa E, Trainini L, Benetti A, Saba E, Fezzardi L, Lorusso B, Borghetti P, Bottio T, Ceri E, Portolani N, Bonardlli S, Giulini SM, Annibale G, Corradi A, Imberti L, Caruso A
Lymphology 2005 Dec;38(4):159-66
Lymphology 2005 Dec;38(4):159-66
Generation and Characterization of Telomerase-Transfected Human Lymphatic Endothelial Cells with an Extended Life Span
Nisato R, Harrison J, Buser R, Orci L, Rinsch C, Montesano R, Dupraz P, Pepper M
The American Journal of Pathology 2004 July;165(1):11-24
The American Journal of Pathology 2004 July;165(1):11-24
Lymphatic regulator PROX1 determines Schlemm canal integrity and identity
Park D, Lee J, Park I, Choi D, Lee S, Song S, Hwang Y, Hong K, Nakaoka Y, Makinen T, Kim P, Alitalo K, Hong Y, Koh G
Journal of Clinical Investigation
Journal of Clinical Investigation
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Western analysis with anti-human Prox-1.
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Immunofluorescence staining (green) of primary human dermal lymphatic endothelial cells (HDLEC) with anti-human Prox-1 (1µg/ml) [Cat# 102-PA32AG] and counter staining of nuclei with Dapi. As secondary antibody goat anti-rabbit ALEXA Flour 488 (Dianova) was used 1:400.
- Sample type
- HDLEC
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Immunofluorescence staining (green) of cryo-sections of human foreskin (fixed 15 min in 4% PFA) with anti-human Prox-1 (dilution 1:200) [Cat# 102-PA32AG] and counter staining of nuclei with Dapi. A) Note the specific green Prox-1 signal in the nuclei of lymphatics (L). Ep, epidermis. Specimen provided by Prof. Dr. J. Wilting, Goettingen. The experiment was performed by PD. Dr. Jörg Wilting, Pädiatrie I, Zentrum für Kinderheilkunde und Jugendmedizin in Göttingen, Germany.
- Sample type
- Human Foreskin
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Prox1 protein in E15 chick pancreas tissue detected by immunohistochemistry studies (IHC) using a polyclonal rabbit anti-human Prox1 antibody ( Cat# 102-PA32AG). [diluted: 1:400]
- Other comments
- The experiment was performed by Andreia Margarido (de Santa Barbara’s team) INSERM U1046, Montpellier, France
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Prox1 protein in E15 chick pancreas tissue detected by immunofluorescence studies (IF) using a polyclonal rabbit anti-human Prox1 antibody ( Cat# 102-PA32AG). [diluted: 1:200
- Other comments
- The experiment was performed by Andreia Margarido (de Santa Barbara’s team) INSERM U1046, Montpellier, France
