Antibody data

Product number
ABIN405903
Provider
antibodies-online
Product name
anti-Sushi Domain Containing 4 (SUSD4) (N-Term) antibody
Provider product page
antibodies-online - ABIN405903
Antibody type
Polyclonal
Antigen
The immunogen for anti-SUSD4 antibody: synthetic peptide directed towards the N terminal of human SUSD4
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine
Host
Rabbit
Antigen sequence
MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILW
FQLAL CFGPAQLTGG
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -