Antibody data

Product number
ABIN502832
Provider
antibodies-online
Product name
anti-Sushi Domain Containing 4 (SUSD4) (Middle Region) antibody
Provider product page
antibodies-online - ABIN502832
Antibody type
Polyclonal
Antigen
The immunogen for anti-SUSD4 antibody: synthetic peptide directed towards the middle region of human SUSD4
Description
Affinity Purified
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYK
YITCQ YGEWFPSYQV
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -