SAB2102341

SUSD4 antibody from MilliporeSigma / Merck KGaA
FLJ10052
No application information provided.

Antibody data

Product number
SAB2102341
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2102341, RRID:AB_10607725
Product name
Anti-SUSD4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2102341
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_001032252.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWF
QLALCFGPAQLTGGF
Storage
-20C
Provider Type Product Number
- No reagents -