HPA003289

FBXO28 antibody from Atlas Antibodies
CENP-30, Fbx28, FLJ10766, KIAA0483

Antibody data

Product number
HPA003289
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003289, RRID:AB_2666879
Product name
Anti-FBXO28
Provider product page
Atlas Antibodies - HPA003289
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MGSPPVPGPSAALTTMQLFSKQNPSRQEVTKLQQQ
VKTNGAGVTVLRREISELRTKVQEQQKQLQDQDQK
LLEQTQIIGEQNARLAELERKLREVMESAVG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -