H00023219-D01

FBXO28 antibody from Abnova Corporation
CENP-30, Fbx28, FLJ10766, KIAA0483

Antibody data

Product number
H00023219-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023219-D01, RRID:AB_10720969
Product name
FBXO28 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00023219-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human FBXO28 protein.
Antigen sequence
MAAAAEERMAEEGGGGQGDGGSSLASGSTQRQPPP
PAPQHPQPGSQALPAPALAPDQLPQNNTLVALPIV
AIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQG
FLKVERYHNLCQKQVKAQLPRRESERRNHSLARHA
DILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVID
EIYRVLRYVNSTRAPQRAHEVLQELRDISSMAMEY
FDEKIVPILKRKLPGSDVSGRLMGSPPVPGPSAAL
TTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRR
EISELRTKVQEQQKQLQDQDQKLLEQTQIIGEQNA
RLAELERKLREVMESAVGNSSGSGQNEESPRKRKK
ATEAIDSLRKSKRLRNRK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -