SAB2100790

FBXO28 antibody from Sigma-Aldrich
CENP-30, Fbx28, FLJ10766, KIAA0483
No application information provided.

Antibody data

Product number
SAB2100790
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100790, RRID:AB_10598928
Product name
Anti-FBXO28 (ab2) antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100790
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_055991.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELERKLREVMESAVGNSSGSGQNEESPRKRKKATE
AIDSLRKSKRLRNRK
Storage
-20C
Provider Type Product Number
- No reagents -