HPA048847

antibody from Atlas Antibodies

Targeting: EPHX1 EPHX

Antibody data

Submit

Validation data

Product number: HPA048847 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA048847, RRID:AB_2680538
Product name: Anti-EPHX1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKN HGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVAT ARIFYKLMLRLGFQEFYIQGGDWGSLICTN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

EPHX1 protein structure - HPA048847 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human adrenal gland and tonsil tissues using Anti-EPHX1 antibody. Corresponding EPHX1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human adrenal gland, colon, liver and lymph node using Anti-EPHX1 antibody HPA048847 (A) shows similar protein distribution across tissues to independent antibody HPA020593 (B).
Antibody #2 product nr: HPA020593
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-EPHX1 antibody HPA048847.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-EPHX1 antibody HPA048847.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-EPHX1 antibody HPA048847.
Sample type: HUMAN